PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_8206949g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 333aa    MW: 37487.5 Da    PI: 5.0851
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_8206949g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.32.3e-201461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d+v+++G g+W++I+r  g+ R++k+c++rw +yl
  MA_8206949g0010 14 KGPWSPEEDRKLIDYVQKHGFGNWRAIPRQAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding42.51.5e-1367112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE++ +++++   G++ W+tIa++++ gRt++++k+ w+++l
  MA_8206949g0010  67 RGSLSPEEEQTILRLHGIIGNR-WSTIASYLP-GRTDNEIKNIWNTHL 112
                      7888******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.5965IPR017930Myb domain
SuperFamilySSF466893.59E-3210108IPR009057Homeodomain-like
SMARTSM007175.9E-171363IPR001005SANT/Myb domain
PfamPF002491.2E-181461IPR001005SANT/Myb domain
CDDcd001672.94E-141661No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129418.44366116IPR017930Myb domain
SMARTSM007174.9E-1266114IPR001005SANT/Myb domain
PfamPF002493.5E-1267112IPR001005SANT/Myb domain
CDDcd001672.49E-971112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRAPCCDKM GVKKGPWSPE EDRKLIDYVQ KHGFGNWRAI PRQAGLLRCG KSCRLRWTNY  60
LRPDLKRGSL SPEEEQTILR LHGIIGNRWS TIASYLPGRT DNEIKNIWNT HLKKRLTQSE  120
RGINSVSTYS ASSLVPTIPP VAINNCWSTS PPMQNSHCFP GSPSSECSFS YSKDSAPQFT  180
ADEIGLHGAQ YDQQLWETSS AHRHETDEKR LADDYINSLK KFLDISEESS SQEHGGEDYD  240
IAGILDPVTE NNYAVISDYI NTEAFFSDST FSGNQLDHEI LQTSLADHSQ EYSSSSNNLH  300
VYTPVSLSPD FLLDFPENPI NVPDVLNPPL WMD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D6QWR71e-72A0A0D6QWR7_ARACU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.16e-67myb domain protein 93